PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.4581s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 415aa    MW: 46443.7 Da    PI: 5.7857
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.4581s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.92.3e-33232286155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k+r+rWtpeLHe+Fveav+qLGGse+AtPk++l+l++++gLt++hvkSHLQkYR+
  Araha.4581s0001.1.p 232 KQRMRWTPELHEAFVEAVNQLGGSERATPKAVLKLLNIPGLTIYHVKSHLQKYRT 286
                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.943229289IPR017930Myb domain
SuperFamilySSF466891.09E-17230286IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-30230288IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-23232286IPR006447Myb domain, plants
PfamPF002498.0E-11234285IPR001005SANT/Myb domain
PfamPF143796.0E-22320366IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MTLANDFGYS TAMSSSFSAL HTTVEDRYRK LPNSFWVSSG QELMNNPVPC QSVSGGNSGG  60
YLFPSPSGFC NVSAVSPHGR NSQNQPPLST VPRERLAMQD CPLEAQPPLL INHHHQEFTD  120
PLPEFFDFSD HVPVQNLQAE SSGVRVDSSV ELHKKSEWQE WADQLISVDD GSEPNWSELL  180
GDSSSHNPNS EIPTPFLDVQ RQEIKANQQQ QVVSSEDQLS GKNSSSSVAT SKQRMRWTPE  240
LHEAFVEAVN QLGGSERATP KAVLKLLNIP GLTIYHVKSH LQKYRTARYK PDTSEVTGEP  300
QEKKMTSIED IKSLDMKTSV EITQALRLQM EVQKRLHEQL EIQRSLQLQI EKQGRYLQMM  360
FEKQQKIQEN KSSSPEASPK QCNGTSAEVE VGLETRTVNQ NEPASASRKR VRED*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00532DAPTransfer from AT5G29000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0023440.0BT002344.1 Arabidopsis thaliana clone C104936 unknown protein (At5g29000) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002874462.10.0myb family transcription factor
SwissprotQ8GUN50.0PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLD7M7060.0D7M706_ARALL; Myb family transcription factor
STRINGfgenesh2_kg.6__2806__AT5G29000.20.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85627117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.20.0G2-like family protein